PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr018379.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family MYB
Protein Properties Length: 288aa    MW: 32314.4 Da    PI: 8.4866
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr018379.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding46.77.6e-151461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+W+  Ed ll ++++ +G g+W++ +++ g+ R++k+c++rw +yl
      Pbr018379.1 14 RGPWSNREDTLLTQYIEAHGEGQWRSLPEKAGLLRCGKSCRLRWMNYL 61
                     89******************************99************97 PP

2Myb_DNA-binding491.4e-1567111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg+ + +Ed+l+++++ +lG++ W++Ia +++ gRt++++k++w++ 
      Pbr018379.1  67 RGNISSDEDDLIIRLHSLLGNR-WSLIAGRLP-GRTDNEIKNYWNTN 111
                      78999*****************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.654961IPR017930Myb domain
SuperFamilySSF466892.58E-2811108IPR009057Homeodomain-like
SMARTSM007172.5E-121363IPR001005SANT/Myb domain
PfamPF002491.9E-131461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.9E-221568IPR009057Homeodomain-like
CDDcd001674.16E-91661No hitNo description
PROSITE profilePS5129424.54862116IPR017930Myb domain
SMARTSM007176.6E-1566114IPR001005SANT/Myb domain
PfamPF002496.3E-1467112IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-2469117IPR009057Homeodomain-like
CDDcd001679.07E-1171112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 288 aa     Download sequence    Send to blast
MGRAPCCSKV GLNRGPWSNR EDTLLTQYIE AHGEGQWRSL PEKAGLLRCG KSCRLRWMNY  60
LKPDIKRGNI SSDEDDLIIR LHSLLGNRWS LIAGRLPGRT DNEIKNYWNT NLSKRLISEG  120
TDPNTHKKLS EPIAKENKRR ENQSCKNRNN KKEMVKVMMK SKTKTGQHVE PQKPKVHLPK  180
PTRITSFLSL PRNDRSTSST TVTPASSIQD LNGGEGGAFG VNPWCNNGVV LCVGDPDQDP  240
INSSADGGDD HTLENLYEEY LQALLTEHHH DHQNQLELDS FAESLLI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-25121165108B-MYB
1h8a_C4e-251211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ9097590.0KJ909759.1 Malus domestica MYBPA1-like transcription factor (MYBPA1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009375421.10.0PREDICTED: myb-related protein 308-like
SwissprotP813931e-67MYB08_ANTMA; Myb-related protein 308
TrEMBLH6S3731e-156H6S373_PRUAV; R2R3-MYB transcription factor
STRINGPOPTR_0002s17460.11e-110(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G22640.12e-67myb domain protein 3